EFTA00269187.pdf

. 10117/22,10:31AM Gmell - Your info was found on the dark web 1271-ACK PlAWe er 5 °C4 A Z- t- 4613 ( A livOcx4.)ctifle-Aff + znr-efur calc.es M Gmail Jacqueline E*GANSED CRtHE CRot-1(1414/— ME-TWORK -fritcern N)6 or raw . Your info was found on the dark web 'I message CP:Feej Re -T : To: > EV t oci.,;ce, c -Th tober 2022 at 05:12 T ti3V4Co)er-falr -LDEMTIT--/ 1-1-1e Fr - 'SARK WES - 3LACR MARKE View in browser _,McAfee logo Identity Protection Services A Your info was stolen! Your date of birth was found on the dark weli) You asked us to keep a look out for‘tDlen_personap ir c7;;;TiE wlExpand your protection by adding more information for us to monitor. Show me Your personal info was stolen in a data breaa, but we're right here with you. We'll guide you through every step of the way to become safer again. if you believe your personal information was added for monitoring by accident or without your approval, you can remove the asset by logging into your account or by contacting McAfee Customer Support for assistance. . in in:I.—I-n.701 • A.••• -- Miteagant=011inlarTtilifirthrilatt.PLIA1746n55364161008493RAMOI=MSCi"3A1746055... 1/3 EFTA00269187  Grind - Your info was found on the dark web 10117722,10:37 AM How did hackers get my info? pany databases you might They usually take it by hacking into com re or sell ail of this info :lave an online account with. Then they sha Internet called the dark to other hackers in remote places in the web. What do they use it for? ess your banking. social Hackers can use this info to try and acc y use it to send you phony media, or shopping accounts. Or, the you out of your credit card links to fake websites that try and trick numbers and other info. How can we help? from the dark web, we warn While no one can get your info back all the ways to take back you when we find it there and show you control from hackers. We're here for you. Stay safe, Q L1cAfee Tear) America, South America, the is bein g sent from : McA fee, LLC (United States, Mexico, Central This message Ireland Limited (Europe, Middle Affairs North, LLC (Canada); McAfee Caribbean, Japan); McAfee Consumer f%3 A1746055... 213 641 6 100849 38simpl=msg- - threada3A17460553 a • ...- ahannw-wymnanmvievigetplaseacch=all&pennthid EFTA00269188 8/25/22, 2:37 PM Goma - Your enquiry to the eSafety Commissioner: Et4Q-2022-0000919 (SECIs0FFICIAL:Sensitivej CRM:0012589 as Gmail RE -Coe-WISED A5 O R.C,PAWW...mtt cpapie Jacqueline AND cie.tritNtv_ Acrwt -ry 1 message Online To: Jacque C 24 August 202 at 09:11 Dear Jacqueline, Thank you for your information received by the Safety Commis;;er>and taking the time to write to us. eemkand we recommend that you seek legal advice and contact the police to rep concerns you have raisedareasedo (The ort criminal activity or orgem et } If you ever feel that you or your family are in immediate danger, please call Triple Zero - 000. If you wish to discuss this matter with a legal professional, you can contact Legal Services Commission South Australia for free by calling Further information about their services Is available from their website here: https://lsc.sa.gov.au The eSafety Commissioner can only investigate matters that are contained in the Online Safety Act 2021 (Cth). We can take action to remove harmful content from the intemet, but we are unable to investigate people or reports of illegal activity. Further information and resources about the eSafety Commissioner's role is available from our website at: www.esafety.gov.au We hope this information is of assistance. Illegal and Restricted Content Team eSafety Commissioner E W www.esafety.gov.au eSafetyCommissioner 1saialist, loscroaawed NOTICE: This email message is for the sole use of the intended recipient(s) and may contain confidential and privileged information. My unauthorized review, use, disclosure or distribution is prohibited. If you are not the intended recipient, please contact the sender by reply email and destroy all copies of the original message. 41.• d nnw 4 /4 EFTA00269189 N29/2021 Gmail - Report Abuse ,*oc Gmail Jacqueline Pearce <== Report Abuse 1 message - REPiZejci\n-v9"TiVe- 29 March 2021 at 14:32 c..*o - n . S`Or.LIE`l HI Jacqueline, We heard you. Please report malicious activity to thsi email. Thank You. •14/_ e-E)AcrtuS 0t.4 car-rce rt LC, Meg ntfil - tc:0 171. bos er/Aii,s EFTA00269190 ciortilaart e: reg. sicfc m - Jacqueline Pearce - Outlook Service Ticket #621581 - Jacqueline Pearce - Email Hack - 0400404658 Pit Stop Technologies Thu 9/07/2020 924 AM To: Hello Jacqueline, Service Ticket # 621581. has been completed. We hope that you are satisfied with the service provided. If you do not believe this ticket has been complete or have concerns, please respond to this email so we can address your queries. __— Thank you, Pit Stop Technologies Team VAVW.glastdu Top REEP:AIC YOtla IT O, ne .4 CX. Ticket #: 621581 Status: Complete Summaryrtacqueline Pearce - Email Hack4f0400404658 Service Record #621581 Summary: Jacqueline Pearce - Email Hack - 0400404658 Company: Jacqueline Pearce Contact: Jacqueline Pearce Phone: 0400-404-658 960 1/1 EFTA00269191  Page 1of1 mew) e-G0C-# *-FecEE3G0K - so site---ss mows ) f•C( 02Ol 1 Subject: New messages from Andrew Leske Fro„a C.Q1OeNCE: F Fite f3t)Ct *, Ta ()S NESS C CON-1- Date: Thursday, 25 Augu 20114:11 PM Andrew Les!ce the Family are going to use their popularity and venue to provide advertising opportunities for small businesses around the towil(aimiiiRroWta a ly —.Pe of business, and not like 3 or 4 hairdressers, once we got one thats it). they have 2 large tvs and a projector coming which they will show your advertising on from 10/1030 -1/130 every single saturday night. i am putting together an info sheet with how many people they get the ages and genders. this works in adelakle, and i c:ftonestly can not see why it wouldnt work here. already spread the word to other places and they are keen as mustard, so I thought i would aask you if be keen. another thing is the original 10 businesses that sign up will be locked into that price so if prices go up you wont need to worry about we (they) are looking at $100 a month or $1000 a year which ever you choose. i think that i have grabbed all the responsibility and workload so you would continually deal with myself have a think and let me know ay Thanks Leske • *• View Conversation on ifacebook • Reply to this email to message Andrew !Asia RE to (M A gkerti<)4 0120 RAIEs et< - pagusH 1\)OLie I t_ccice.-_rf) . ACCESS TO FA es - C:r.reitrit<6 PROF6SS(01%‘Al- c:c. v 14/24C, Recis.).657-co copy or PAsseorr ti0 tlEtC (1&"Ct -TO d RCA-FE rACEBCOt. Ar7r 0 t•C e2O 620 . RACE: cc < PROF10E- (.4,QtY Or4 CKS-Or EFTA00269192 ce.SOAL RCaer - SLACK tilARICer Ext.),V- A/30,SE RING - ,oNtirk 7/14/2020 Mail - Jacqueline Pearce - Outlook [RSVP up ort Re: RE Su port] Re: uspected rofile theft black market sex ro de the xual targetin. Tue 26/04/2016 3:21 AM To: Jacqueline Pearce ## Please type your reply above this lInc -4tC Your request (#31318Q) has been updated. To add additional comments, reply to this email; i c- Nick (RSVP Support) • la 26 Apr, 08:21 Dear Jacqueline, Thank you for your email. We are more then happy to provide any and all information relating to your profile. However, we are unable to locate any recent profiles with the exception of Degreesofvariability.* — ONCitN)C t /N'T (NI& CROHLE As this profile has been inactive for a period over 6 months all contact history and content has been permanently deleted from our servers. I can reactivate this profile for to see if there is any information that may be of use to yourself. If you wish for this to be actioned could confirm your date or birth I can reactivate this profile on your behalf. Kind regards, Nick Customer Support Executive Pty Ltd ABN 86 067 935 737 Where more Australians meet. Jacqueline Pearce 25 Apr, 18:19 theft - This is a follow-up to your previous request 01236€ "Suspected profile Dear Nick, Thankyou for contacting me as quickly as possible. targeting I am in the middle of legalities involving the suspected sexual which include orchestrated by a group of prominent people in prominent positions EFTA00269193 7/14/2020 SEX- ee- A tSSn -X-1 Mal-Jacqueline Pearce -outlook RefORC INY.A • --- r ttl ASS‘ST DeMIETD , Jacqueline Pearce 26 Apr, 12:01 This is a follow-up to your previous request #313180 "RE: [RSVP Support] Re: Susp..." Dear Nick, Thank you very much for the information. Yes, that is my profile of which was in use upon your site. Birth date - Just a query.. Are you able to extract the information from the main hard drive of your system? Although this may take some time and be of an inconvenience to your staff it is of high importance and priority concerning the circumstances. I fear and suspect that I may not be the only victim of this crime and the information of which I am asking is of high importanc- d •ersonal contact with a member of your service which resulted in exual assault. 2 c This member had been in contact with myself in the yea 20T2F.7 Any information of which I have requested and of which you could supply will be greatly appreciated. Kind Regards • Jacqueline Pearce This email is a service from RSVP Support. EFTA00269194  • • • WM.0011.../ Mall - Jacqueline Pearce - Outlook .M- cRa's 000_6 A cc..Q6NTS Microsoft account unusual sign-in activity Microsoft account team jsr Wed 21/10/010:07 AM Ac To: Mi X Unusual sign-in activity* We detected something unusual about a recent sign-i n to the Microsoft account To help keep you safe, we required an extra security challenge. Sign-in details: Country/region: Australia IP address: Date: 10/21/2015 10:07 AM (LHST) If this was you, then you can safely ignore this email. If you're not sure this was you, a malicious user might have your password. Please review your recent activity and we'll help you take corrective action. To opt out or change where you receive security notifications click , here. Thanks, The Microsoft account team https://oullookilve.corn/mall/O/M1MIADAwATNOrnYAZC1jM2U5L TZhNWMOADACLTAwegAuAAADXVQ1yWIcnOla0W4CohQ6G AEAXoEEIVe2F... 1/1 EFTA00269195  7/13/2020 Mel- Jacqueline Pearce - Outlook kith SEcO CTy - ACCOUNT- rt —rf ) ics op perrE Microsoft account security info Microsoft account team +; Thu 11/021 0,8:56 PM To: At Microsoft account 4t Security info replacement AE. Someone started a process to replace all of the security info for the Microsoft account • If this was-you, you can safely ignore this emaAour security info will be replaced with when the 30-day waiting period is up. . Click If this wasn't you, someone else might be trying to take over here and we'll help you protect this account Thanks, The Microsoft account team Ili.42U5LTZhNWMIMDACLTAwCgAuAAADXVOlyWIcri0taOW4CohO6GAEAXGEEM2F... 1/1 EFTA00269196 7/13/2020 . Mail - Jacqueline Pearce - Outlook Ct I POSS woKv or oft=yre- sctue try * Your password changed Google <r Wed 5/121 1 ) 11:10 AM 4 * Go gle Hi Jacqueline, The password for your Google Account was recently changed. Don't recognize this activity? Click here for more information on how to recover your account. The Google Accounts team Help Center. This email can't receive replies. For more information, visit the Google Accounts Google product or You received this mandatory email service announcement to update you about Important changes to your account. t 2018 Google LLC, 1600 Amphitheatre Parxway, Mountain View, CA 94043. USA oh06GAEAXoF Ei%2F.. . 1/ IFINIIIIIIIII/maill0/A0MkADAwATNIZmYA2C1jM2USLT2hNWMtMOACLTAK:gAueAADXVCOMIcnOia0W4C EFTA00269197  Q.C) Mel - Jacqueline Pearce - 7/13/2020 1—‘1:3CACI NY% RavloTe G(A) AcE toicce5 LOH POIEA Microsoft account unusual sign-in activity Microsoft ount team < kr. Wed 10 06 020 0:22 AM To: Microsoft account Unusual sign-in activity*' sign-in to the Microsoft accoune We detected something unusual about a recent Sign-in details Countrnregion: Australia IP address: Date: 6/10/2020 10:22 AM (LHST) Platform: Mac OS Browser - you, we'll nt activ ity pag e to let us kno w whe ther or not this was you. If this wasn't Please go to your rece the future. was you, we'll trust similar activity in help you secure your account.If this ive security notifications, click here. To opt out or change where you rece Thanks, The Microsoft account team 515 VCIlyWico0laOW4Cotio6GAEAXoEEI%2F... IM2U5LTZhNWIMMDACLTAwCgAuAAADX EFTA00269198  11t 21020 Gmal -.Secunly alert change your Weft password 14/9_090 POI Gmail * Security alert: change your Netflix password *. 1 message ix 23 September (020~t 16:16 To: Ne ME1TL) Action needed: reset your password Dear Jacqueline, * We've detected a suspicious sign-in to your Netflix* account. Just to be safe, we've reset your password and you'll need to set a new one. Use the button above, or type www.netflix.com into your browser, click on "Sign in" and then click "Need help?" Follow the instructions to set a new password. If you have any questions, we are here to help. Visit the Help Centre for more info or contact us. —The Netflix Team VIEW ALL TV SHOWS & MOVIES Questions? Visit the Helo Centre. Netflix International B.V. 678606... 112 EFTA00269199  c meal-6K HP pescrc p QC2I gLer cei ? NC, _HO L-4OO0 S OCT+ i - C- NA g t_ SVszceas Gina - Reporting Fraudulent Activity 3/2912021 ail.c Jacqueline Pearce 1.c.pearce456@gm M Gmaii Reporting Fraudulent Activity 1 message 29 March 2021 at Ja > Toe Dear GoDaddy, Higher Authority, a case of Malicious Fraudul the adv ice of you r rep res ent ativ e Cristina, Sydney on reporting I am contacting you on ONS, customer business account JC INNOVATI Activity that has occurred in my has targeted numerot ts has bee n occ urri ng over a 10 year period and The Fraudulent activity targeting my acc oun accounts and recently ts, em ail acc oun ts, computer hacking, Centrelink accounts, Wilily accounts. Pho ne acc oun which has been report( ing Ho use Aus tin Macauley Publishers, London Netbank electronic transfers to my Pub lish n. On Thursday i have reporte with the Fraud Divison for investigatio d to the Commonwealth Ban k tod ay and pla ced iness account that has Restricte urri ng for the sec ond tim e in my Telstra Mobile phone bus l acc oun ts with 2 diff ere nt Fraudulent Activity occ occurred in my -Jersona s Fraudulent Activity that has t with Teistra Head Access because of the previou re, Kad ina and escalated toteguesting contac servers. This report was made in the lels tra Sto Nrri r I E..p We) con tinu ous Fra udulent Activity. )1F -Leee n and rep orte d as CANEQ,S . -# office CEO for investigatio CE - Re eeCle- ACIESS ivi' C....c_ICEP-I CA -ne t‘IT SO OR sual activity or suspicious act Pot. ativ e of you r com pan y to contact and report any unu the pre viou s hac kin g of m ent representative of I was informed by a repres as i had info rme d the s of this account, malware report on that comput er. occurs during the setup proces acc oun t, which resulted in 136,000 tem and em ail previous computer sys registered business nar new com put er system registered in my d Following this report of the malwa re i pur cha sed a urity systems, newly create put er tec hni cian , wh ich included numerous Sec ber . Thi s new ly cre ate d and professionally setup by a Com ss pho ne acc oun t and new phone num as a my newly created bus ine S and not accounts and emails and und er the bus ine ss registration JC INNOVATION er were registe red accounts and business comput mpted me to get the personai user. hac king attempts in 2 days which pro computer system i rec eive d 96 Security measures installed —4 On start up of the new hno log ies, Kad ina for the computer set up and Pitstop Tec support of the IT Specialist ts i t and newly created accoun com put er, new ly cre ate d business phone accoun the Following this news set up of ivity in these accounts. to rec eive sus pici ous sign ins and suspicious act started 0 connected to the email my novel 31st October 202 sign ins to social media, blo cked contact with my Following the publication of sus pici ous ess to Soc ial Me dia , ail address to my phone started to receive blocked acc com ing thro ugh to the synchronisedme ail of this em ails publishing_house, fraudulent em not rec eivi ng on my com puter. i was with Malicious Activil as being targeted and hacked I am reporting the email tion into my account. am requesting an investiga and Fraudulent Activity and my account e rec ent ly rem ove d the 2 step verification on d my phone number and hav verification on my I have once again change det ails , pas swo rd, phone number, 2 step the stages of changing the my details to this process and am in t an inve stig atio n into this account before i change es but wished to req ues account for security purpos n occurring for you to reviev e of the targ ete d ma licious activity that has bee ented evidenc it s I have attached docum . ues t to inv estigate this matter further part of this req matter. assistance regarding this appreciate your time and Kind Regards Jacqueline Pearce JC INNOVATIONS CC 50Pf'r...I - RCI, Ogrie.A.11004 4 2 attachments L aj 1. Report,pdf 2000K EFTA00269200  here. Gmail - Thanks for your report. Well take it from 3/2912021 gmail.c Jacqueline Pearce •1.c.pearce456@ Gmail from here. Thanks for your report. We'll take it 2 messages 29 March 2021 at • 24/7 Support: er Number: GoDaddy Customer— Custom GoDaddy ur Thanks for submitting yo report. lt review your complaint and particular outcome, but we We can't guarantee any . contact you only if necessary itional submissions you r rep ort usi ng the abuse reporting form, add If you submitted t. If you've 24 hou rs wo n't rec eiv e another notice of receip from this address within ow for any future ail, con sid er usi ng the abuse reporting form bel submitted via em complaints. these resources: For other issues, check out complaints Trademark or copyright Submit them here. Domain disputes -Resolution Policy. ICA NN 's Un ifor m Domain-Name Dispute Please refer to Account changes EFTA00269201  4166- UMBER / tARRKETIW. POSLISHC11) P.;01 90,20 - (Weil? W..cace,c) MeRKETI ItiC RECeiOM4C; CONTACT tJeu_ STREFT If plioN)E SERVICE- elvli) U._ Icrr RecEivi C otv sykttiRoNtscn cot-ten-ER CMfflL sakvice - TeR..ciET0QC Linkedln Simon Sinek and others share their thoughts o Here are your network highlights Linkedln Simon Smek shared a post: On January_ Here's what s happened since you were last on Linkedln Forbes and others share their thoughts on unk. Here are your network highlights Linkedln N C c 110 Simon Sinek shared a pool: We all.. Here's what's happened since you were lest on.. C inkedln their. . - e Wall Street Journal and others share ere we your network heohlights 0( ) (61+ Linkedln your netw. Holly, add Atlyson Carpenter MBA to cc P- Add connections to discover new opportunitie_ vt's Linkedln 0. t WORK i.OR SA .7. Icf.is:7; dr••:9 V.:In.:9110 Hotly jati, scn WORK, f-rift EFTA00269202  t-tonbeen(QC VI DEO St, t3M inex3 mr*Ken &C.4 pePaRmiari- FOR SOcilfte- meo ke EsPoskAe-- Ni O N01 MARKET NOQEL, Holly Jackson Rae! %Jab From: Linkedin < t.-X) Sent To: Tuesday, 24 November 2020 6:43 PM Holly Jackson ax- tec Mane s n-t; Subject Congrats! Your video is ready to watch! Euxten rteRiteriNct Holly Jackson Congrats! Your video is ready to watch! Reality - A riveting, thought provoking journey of one... Go to Linkedin Get the LinkedIn app. Stay updated wherever you are Download for free Unsubscribe I Halo You are receiving Linkedin notification emails. Learn This email was intended for Holly Jackson (Book Author at JC INNOVATIONS). why we included this. Mr' (0 2020 Linkedin Ireland Unlimited Company, lAfilton Plaza, Wilton Place, Dublin 2. Linkedin is a registered business name of Linkedin Ireland Unlimited Company. Linkedin and the Linkedin logo are registered trademarks of Linkedin. EFTA00269203  TG cmeic, ADDRESS PROM HorJE "140 PRt 3/2912021 DIID "tr Realue ON) at -In -I W- e're t° see you go P01 Gmail Jacqueline Pearce FW: We're sorry to see you go 1 message b9t Hol k acksa 1 29 March 2021 at 15:10 k To: c riceicc ("Howe- SY,\IC.Ht:c.t.:itSCiTh y frior r fib NCT Beta:( c cc friruirik emost ≤ is Tow 5 . FiCCCO•Yr Cue F- Rteit-MXL-;\-ti Sent from my Samsung Galaxy sman,ohone. -- Original messaoe From: Linkedln Date: 24/3/216:6 it To: Holly Jackson Subject: We're sorry to see you go LinkedMI We're sorry to see you go Your Linkedln account is now closed. Although you no longer have access to it, it'll take a few weeks for your public profile to disappear from search engines. You may still receive invitations from Linkedln members and groups. You may reactivate your account within 14 days from today by signing back in, or if you wish to reactivate within the next 48 hours, you may use this link: Reactivate my account Thanks, The Linkedln Team This email was sent to [email protected]. Linked® 94085. '112021 Linkedln Corporation. 1000 West Maude Avenue, Sunnyvale, CA Linkedin. Link:feta ei iutne Linkedln Iccio are rigistacad tradeMartis of EFTA00269204  TC.J C-Tiwto MCLcci\TC - holt./ jac Le-or)C1 4/,„:Finn°\;olionS .aftl \jos/ By THIS nactiCiT HAS Si.."...c.PtAIDED c),:e. -co -THE Socr'ciocs Holly Jackson Th)riTER 13Lcci•eal NeRt=e- ritt CF Pc:ex-I:Si-Celt) &CK From: Twitter .1 • Sent Wednesday, 11 Noyembe 020)0:08 AM 4K - (Nz.Y-CTI pa/A To: ollya BCCC compaeCet • Subject new or unusual Twitter login ,V (tac tSHI Net Hot. a,tirtPCI conrittilc r V that seem you? If this was you Just to be safe, to log in to this account you'll need to verify this is really you by entering the following single- use code. jqrvrvk8 If this wasn't you Complete these steps now to protect your account. • Change your password. You'll be logged out of all your active Twitter sessions except the one you're using